DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG4998

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:271 Identity:84/271 - (30%)
Similarity:135/271 - (49%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GISHGAPQMGRVVNGT----DSSVEKYPF---VISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR 76
            |:.:.|...||:.|..    ||...:||:   ::........::|||::|..|.:::||||...:
  Fly   922 GVRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQ 986

  Fly    77 KASDLSVQYGVTKIN---ATGPNVVR-VKKIIQHEDYNPYNNYA----NDISLLLVEEPFEF-DG 132
            ...||.|:.|...:|   ...|.:.| |..:..|.:|     ||    ||:::|.:::|.:| ..
  Fly   987 NGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEY-----YAGTLDNDLAVLKLDQPVDFTKN 1046

  Fly   133 VTVAPVKLPELAFATPQTD-AGGEGVLIGWGLNATG--GYIQSTLQEVELKVYSDEECTER---- 190
            ..::|..||:     ..:| .|......|||.:|.|  |..|:.|:||::.:.|.::|..:    
  Fly  1047 PHISPACLPD-----KYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNT 1106

  Fly   191 ---HGGRTDPRYHICGGVDEGGKGQCSGDSGGPLI--YNGQQ--VGIVSWSIKPCTVAPYPGVYC 248
               :..:.:|.: :|.|.:| ||..|.||.||||:  .||..  ||:|||.| .|.....||||.
  Fly  1107 RLGYSYKLNPGF-VCAGGEE-GKDACKGDGGGPLVCDRNGAMHVVGVVSWGI-GCGQVNVPGVYV 1168

  Fly   249 KVSQYVDWIKK 259
            |||.|:.||::
  Fly  1169 KVSAYLPWIQQ 1179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/257 (31%)
Tryp_SPc 30..259 CDD:238113 80/258 (31%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 79/251 (31%)
Tryp_SPc 942..1177 CDD:214473 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.