DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:266 Identity:82/266 - (30%)
Similarity:123/266 - (46%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHG------APQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQF 65
            |.|||.:......:.|.      |...||:.||..:...|.|:.:.: |.||...|||||||.::
  Fly     8 LALAVASASAYESVVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGL-GFSGGWWCGGSIISNEW 71

  Fly    66 VMTAAHCTDGRKASDLSVQYGVT-KINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
            |:||.||..|   ..::|.:|.| :.||...:.|.....|.|.        :.||:|:.:  |..
  Fly    72 VLTAEHCIGG---DAVTVYFGATWRTNAQFTHWVGSGNFITHG--------SADIALIRI--PHV 123

  Fly   130 FDGVTVAPVKLPELAFATPQTDAGGE-----GVLIGWGLNATGGYIQSTLQEVELKVYSDEECTE 189
            .....|..|:||.      ..|...:     .|..|||....|..:...||.|:|::..:.||..
  Fly   124 DFWHMVNKVELPS------YNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECAS 182

  Fly   190 RHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLI-YNGQQ-VGIVSWSIKPCTVAPYPGVYCKVSQ 252
            .:|..|.....||..|.: |||.|.|||||||: ::|.: ||:.:|.......|.:|..:.:|:.
  Fly   183 YYGTGTVGDNIICVRVVD-GKGTCGGDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTY 246

  Fly   253 YVDWIK 258
            ::|||:
  Fly   247 HLDWIR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/235 (31%)
Tryp_SPc 30..259 CDD:238113 74/237 (31%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 73/235 (31%)
Tryp_SPc 37..254 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.