DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and yip7

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:242 Identity:86/242 - (35%)
Similarity:121/242 - (50%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRVVNGTDSSVEKYPFVI--SMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKI 90
            ||:.||.|:...::|:.:  |...|:||..||||||..::|:||||||||  |:.:::.||.|. 
  Fly    38 GRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCTDG--AASVTIYYGATV- 99

  Fly    91 NATGP---NVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDA 152
             .|.|   .||...|..|||.|... ...|||||:.... ..| ..||..:.||.:: .:..|..
  Fly   100 -RTSPEFTQVVSSSKFRQHESYLAL-TIRNDISLIQTSS-VSF-SATVNKISLPAVS-NSYSTYE 159

  Fly   153 GGEGVLIGWGL---NATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQ-C 213
            |...|..||||   .||.  :...||.|:|.:.|:.:|.|..|........:|  ||...|.. |
  Fly   160 GKTAVASGWGLTSDQATA--VSRDLQYVDLTIISNSKCQETFGSLIVTSRVLC--VDTTNKASTC 220

  Fly   214 SGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            .|||||||..:|..:|..|:.......:..|..:.:::.|.||||::
  Fly   221 QGDSGGPLALDGVLIGATSFGSADGCESGAPAAFTRITYYRDWIKET 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 82/236 (35%)
Tryp_SPc 30..259 CDD:238113 83/237 (35%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 82/236 (35%)
Tryp_SPc 40..267 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.