DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and mas

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:251 Identity:76/251 - (30%)
Similarity:114/251 - (45%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDG--RKASDLSVQYG----V 87
            |||.|.|....::.:.:::..|...:.||.::|..|:|:|||||...  |....:.|:.|    .
  Fly   802 RVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLT 866

  Fly    88 TKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEF-DGVTVAPVKLPELAFATPQTD 151
            .|..:.|...:||.....|.::|. ....|||:||.:....|. |||.:..:....::.|     
  Fly   867 RKYGSPGAQTLRVATTYIHHNHNS-QTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHA----- 925

  Fly   152 AGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTD-----PRYHICGGVDEGGKG 211
            ||....:.|:|.....|.|...::|.|:.:.||.||..:....|:     |....|.|.:| |..
  Fly   926 AGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEE-GHD 989

  Fly   212 QCSGDSGGPLIYNG----QQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKSQII 263
            .|.||.||||:...    :..|:|||.. .|.....||||.|.|.::.||  :|||
  Fly   990 ACQGDGGGPLVCQDDGFYELAGLVSWGF-GCGRQDVPGVYVKTSSFIGWI--NQII 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 71/243 (29%)
Tryp_SPc 30..259 CDD:238113 72/244 (30%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.