DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG32277

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:245 Identity:73/245 - (29%)
Similarity:119/245 - (48%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR--KASDLSVQYGVT 88
            :.|::..|..:.|:.:.|::::| ..|...|||.|||...|:|||||.:||  :..||:|.   .
  Fly    23 RQGKIFGGKTTLVKDHSFLVNLR-RGGKFRCGGVIISPNCVLTAAHCLEGRYQQVRDLTVH---A 83

  Fly    89 KINATG----PNVVRVKKII-QHEDYNPYNNYANDISLLLVEEPFEFDG-VTVAPVKLPELAFAT 147
            :....|    |..||....: ...:|.......:|::::.:..||:..| .::..:...:|   .
  Fly    84 QQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYNDL---P 145

  Fly   148 PQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEECTERHG-GRTDPRYHICGGVDEGGK 210
            |.::.    .::||| :|..|......|||..:|:.|..||.:..| |......::...:.:..:
  Fly   146 PHSNL----TVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFCALGKNAR 206

  Fly   211 GQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS--QYVDWIK 258
            ..|.||||||.||.|:.||||||.. .|. :.|||||.::|  ....|:|
  Fly   207 DACQGDSGGPAIYAGRSVGIVSWGY-GCG-SGYPGVYTRLSSPSITYWLK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/239 (29%)
Tryp_SPc 30..259 CDD:238113 72/241 (30%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 69/232 (30%)
Tryp_SPc 27..246 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.