DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK2

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_005542.1 Gene:KLK2 / 3817 HGNCID:6363 Length:261 Species:Homo sapiens


Alignment Length:260 Identity:75/260 - (28%)
Similarity:127/260 - (48%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VFALLTTAGISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTD 74
            |.::..:.|.:...|.: .|:|.|.:......|:.:::.....:| |||.::..|:|:|||||. 
Human     5 VLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAH-CGGVLVHPQWVLTAAHCL- 67

  Fly    75 GRKASDLSV-QYGVTKINATG---------PNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
             :|.|.:.: ::.:.:...||         |:.:....:::|:...|..:.::|:.||.:.||.:
Human    68 -KKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAK 131

  Fly   130 FDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQ-STLQEVELKVYSDEECTERHGG 193
            ...|    ||:  |...|.:...|......|||......::: .:||.|.|.:.|::.|...:..
Human   132 ITDV----VKV--LGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSE 190

  Fly   194 RTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            :. ..:.:|.|:..|||..|.|||||||:.||...||.||..:||.:...|.||.||..|..|||
Human   191 KV-TEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIK 254

  Fly   259  258
            Human   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 69/238 (29%)
Tryp_SPc 30..259 CDD:238113 71/240 (30%)
KLK2NP_005542.1 Tryp_SPc 25..256 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.