DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK1

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:268 Identity:85/268 - (31%)
Similarity:126/268 - (47%) Gaps:34/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            ||||    |:..|.....|...|:|.|.:......|:..::...| :..|||.::.:|:|:||||
Human     6 LCLA----LSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFS-TFQCGGILVHRQWVLTAAH 65

  Fly    72 CTDGRKASDLSVQYGVTKIN----ATGPNVVRVKKIIQHEDYN----------PYNNYANDISLL 122
            |     .|| :.|..:.:.|    ......|.|.:...|..:|          ...:|::|:.||
Human    66 C-----ISD-NYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLL 124

  Fly   123 LVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEE 186
            .:.||  .|.:|.| ||:.||  .|.:.:.|...:..||| :..........||.|:||:..::|
Human   125 RLTEP--ADTITDA-VKVVEL--PTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDE 184

  Fly   187 CTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKV 250
            |.:.|..: ||  :.:|.|..||||..|.|||||||:.:|...|:.||...||.....|.|..:|
Human   185 CKKAHVQKVTD--FMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRV 247

  Fly   251 SQYVDWIK 258
            ..||.||:
Human   248 LSYVKWIE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/243 (31%)
Tryp_SPc 30..259 CDD:238113 77/245 (31%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.