DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG13430

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:272 Identity:82/272 - (30%)
Similarity:133/272 - (48%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAG-ISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAA 70
            |.:|::.:.|:|. .|....|.||:|.|.::.:..:|..:|::..: .|:|||:|||...::|||
  Fly     8 LAVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGT-RHACGGTIISPNIILTAA 71

  Fly    71 HCTDGRKASDLSVQYGVTKINAT----GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFD 131
            ||.    ......||.|.:..::    |.:.:||||||.|.:::......|||:::.:::|..: 
  Fly    72 HCV----LEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVY- 131

  Fly   132 GVTVAPVKL---PELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELK-----VYSDEECT 188
            ...:.|:.|   .::...|.|.      .:.|||..:    |.....|..|:     :....:|.
  Fly   132 SQDIRPISLATSKDIIMPTAQL------FVSGWGSTS----ISQMQPEKRLRYTVVHLRDQNQCA 186

  Fly   189 ERH-GGRTDPRYHICGGVDEGGKGQCSGDSGGPLI--YNG--QQVGIVSWSIKPCTVAPYPGVYC 248
            ..: |..|......|.|...||:..|.|||||||:  .:|  :..|||||.. .|..|.:||:|.
  Fly   187 RNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGF-GCANAMFPGIYT 250

  Fly   249 KVSQYVDWIKKS 260
            |||.|.|||.::
  Fly   251 KVSAYDDWIAQT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/244 (30%)
Tryp_SPc 30..259 CDD:238113 74/245 (30%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 73/244 (30%)
Tryp_SPc 32..262 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.