DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG32269

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:230 Identity:73/230 - (31%)
Similarity:114/230 - (49%) Gaps:15/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            |:|.||.:::...|:::.:|  .||:.|.||:|::|:|:|||||..|..|||.:|:.|.|.::.:
  Fly   108 RIVGGTSTTISTTPYIVQLR--RGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTTLDGS 170

  Fly    94 GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVL 158
             ..|.|....|.............|.:||.:.:  ...|..:..:.:     ...:..||....:
  Fly   171 -DGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQ--SLTGTNIGTISM-----GNYRPKAGSRVRI 227

  Fly   159 IGWGLNATGGYIQS-TLQEVELKVYSDEECTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPL 221
            .|||:...|....| |||..:::|...::|.:.:.|: |..:|.:|...  .||..||||||||:
  Fly   228 AGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCARA--AGKDSCSGDSGGPV 290

  Fly   222 IYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            ..|...:||||:.. .|..|.|||||..|.....|
  Fly   291 TRNNTLLGIVSFGY-GCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/230 (32%)
Tryp_SPc 30..259 CDD:238113 72/229 (31%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 72/228 (32%)
Tryp_SPc 121..324 CDD:238113 68/215 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.