DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG11192

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:262 Identity:84/262 - (32%)
Similarity:137/262 - (52%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC-TD 74
            :.||:..||.: ..|..||:|.|..::::::|:.:|:: ..|.|.|||:||....|:||||| .|
  Fly    10 LMALVAYAGAT-PTPGDGRIVGGEVATIQEFPYQVSVQ-LQGRHICGGAIIGIDTVLTAAHCFED 72

  Fly    75 GRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVK 139
            ...::|.:|:.|.:: :.:|.:|:.::::|.|.|||| .::.||::||::.....|. ..:.|| 
  Fly    73 PWSSADYTVRVGSSE-HESGGHVLSLRRVIAHGDYNP-QSHDNDLALLILNGQLNFT-EHLQPV- 133

  Fly   140 LPELAFATPQTDAGGEGVLIGWGLNATGGYIQS------TLQEVELKVYSDEECTERHGGRTDP- 197
             |..|.|.|.| |.....:.|||..|....:..      .|:.|::.:....:| .|...:..| 
  Fly   134 -PLAALADPPT-ADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC-RRAYSQVLPI 195

  Fly   198 -RYHICGGVDEGGKGQCSGDSGGPLI-YNGQQ-----VGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
             |..||..  ..|:..|.|||||||: |..::     .|||||.: .|....:||||..|:.:..
  Fly   196 TRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFPGVYTNVAAFRS 257

  Fly   256 WI 257
            ||
  Fly   258 WI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 76/242 (31%)
Tryp_SPc 30..259 CDD:238113 77/243 (32%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 76/242 (31%)
Tryp_SPc 28..262 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.