DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Ser8

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:261 Identity:101/261 - (38%)
Similarity:139/261 - (53%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHG-APQM----GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMT 68
            ||:.||...|.|..| .||.    ||:|.||.||:|..|:.:|:: .||||.|||||||...::|
  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQ-RSGSHFCGGSIISNNIIVT 72

  Fly    69 AAHCTD-GRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDG 132
            ||||.| ....|:|.::.|..| ...|..:|.|..|..||.||. |:..|||.::.::....| |
  Fly    73 AAHCLDTPTTVSNLRIRAGSNK-RTYGGVLVEVAAIKAHEAYNS-NSKINDIGVVRLKTKLTF-G 134

  Fly   133 VTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEEC-TERHG-GRT 195
            .|   :|...:|.|||.  .|....:.|||..:|.|...:||..|:.::....:| :..:| |..
  Fly   135 ST---IKAITMASATPA--HGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSF 194

  Fly   196 DPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            .....||....  .|..|.|||||||:..||.||:|||. :.|.||.|||||..:::..||:.::
  Fly   195 IKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWG-RDCAVANYPGVYANIAELRDWVLQA 256

  Fly   261 Q 261
            |
  Fly   257 Q 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 89/230 (39%)
Tryp_SPc 30..259 CDD:238113 89/231 (39%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 89/230 (39%)
Tryp_SPc 35..253 CDD:238113 88/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.