DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and iotaTry

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:130/263 - (49%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTA------GISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVM 67
            :||:.::.|.      |.:......||::.|:|..:...|:.:|:: .|..|.|||.|.||:.::
  Fly     1 MAVYGIVATVLVLLLLGDASDVEATGRIIGGSDQLIRNAPWQVSIQ-ISARHECGGVIYSKEIII 64

  Fly    68 TAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNP-YNNYANDISLLLVEEPFEFD 131
            ||.||...|..:.:.|:.|....| .|..:|.|.....||.::. :.:|  ||::|.:..|..| 
  Fly    65 TAGHCLHERSVTLMKVRVGAQNHN-YGGTLVPVAAYKVHEQFDSRFLHY--DIAVLRLSTPLTF- 125

  Fly   132 GVTVAPVKLPELAFATPQTDAGGEGVLI-GWGLNATGGYIQSTLQEVELKVYSDEECTER---HG 192
            |::...:   .||..:|   :||..|.: ||| :...|.:..:||:.:|::....||..:   :|
  Fly   126 GLSTRAI---NLASTSP---SGGTTVTVTGWG-HTDNGALSDSLQKAQLQIIDRGECASQKFGYG 183

  Fly   193 GRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            ........||....:.  ..|:|||||||:.:.|.||||||..: |....|||||..|:....||
  Fly   184 ADFVGEETICAASTDA--DACTGDSGGPLVASSQLVGIVSWGYR-CADDNYPGVYADVAILRPWI 245

  Fly   258 KKS 260
            .|:
  Fly   246 VKA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/232 (31%)
Tryp_SPc 30..259 CDD:238113 74/233 (32%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 73/232 (31%)
Tryp_SPc 28..247 CDD:238113 74/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.