DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and thetaTry

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:261 Identity:96/261 - (36%)
Similarity:132/261 - (50%) Gaps:24/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAV-FALLTTAGISHGAP--QMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMT 68
            :|||| .|...|.|:|:|.|  :.||:|.|.|:::..:|:.:|::..||||.||||:|::..|:|
  Fly     9 VCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVT 73

  Fly    69 AAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGV 133
            ||||..|||.|.:.|:.|.|..| .|..||.|:::..:||||. .....|:.:|.::|..:    
  Fly    74 AAHCLVGRKVSKVFVRLGSTLYN-EGGIVVAVRELAYNEDYNS-KTMEYDVGILKLDEKVK---- 132

  Fly   134 TVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGY-----IQSTLQEVELKVYSDEECT--ERH 191
            ....::..|||..||.|  |...|:.|||...   |     :..|||||.:.:...:.|.  |..
  Fly   133 ETENIRYIELATETPPT--GTTAVVTGWGSKC---YFWCMTLPKTLQEVYVNIVDWKTCASDEYK 192

  Fly   192 GGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            .|.......:|  ..|..|..|.|||||||......||||||.. .|.....||||..|.....|
  Fly   193 YGEIIYDSMVC--AYEKKKDACQGDSGGPLAVGNTLVGIVSWGY-ACASNLLPGVYSDVPALRKW 254

  Fly   257 I 257
            |
  Fly   255 I 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 83/234 (35%)
Tryp_SPc 30..259 CDD:238113 84/235 (36%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 83/234 (35%)
Tryp_SPc 35..255 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.