DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG1773

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:117/261 - (44%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFV--ISMRGSSGSHSCGGSIISKQFVMTAAHC----------------TDG 75
            |:..|..||:...|::  :.:.|......||||::|:.||:|||||                .|.
  Fly    61 RITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDI 125

  Fly    76 RKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNP-YNNYANDISLLLVEEPFEFDGVTVAPVK 139
            ...|| .|.|...::.|.......:.|.|.||::|. |..|  ||:|:.:.:...|.. .:.|:.
  Fly   126 SSTSD-CVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY--DIALIKLNKKVVFKD-HIRPIC 186

  Fly   140 LP---ELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHI 201
            ||   ||...|.|  .|...:.:|||...:..:..||: ||.:   :.|:||:   || |..:..
  Fly   187 LPLTDELLAFTLQ--LGQSYMAVGWGRTESRRFANSTM-EVHI---NTEKCTD---GR-DTSFLC 241

  Fly   202 CGG--VDEGGKGQCSGDSGGPLIYN----GQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDW 256
            ..|  ||     .|:||||||||:.    |:    |.|:||...:.|. |.....|..|..||.|
  Fly   242 ANGDYVD-----TCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPW 300

  Fly   257 I 257
            |
  Fly   301 I 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/259 (31%)
Tryp_SPc 30..259 CDD:238113 80/260 (31%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 79/259 (31%)
Tryp_SPc 62..301 CDD:238113 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.