DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG17571

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:262 Identity:90/262 - (34%)
Similarity:135/262 - (51%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQM----GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVM 67
            |.|:|.||:..|...||.|.:    ||:|||.|..:|.||:.:|::.:.|||.||||:|..:.|:
  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68

  Fly    68 TAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDG 132
            |||||.....||:|.|:.|.|. .::|..||.|:....||.||. ....||::::.:..|..   
  Fly    69 TAAHCMQSYAASELQVRVGSTS-RSSGGEVVTVRAFKYHEGYNS-KLMINDVAIIKLSSPVR--- 128

  Fly   133 VTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYI----QSTLQEVELKVYSDEEC---TER 190
               ...|:..:..|..:..:|...|:.|||   |..::    ..|||:||:.:...::|   |..
  Fly   129 ---QTSKIRAIELADSEAVSGTNAVVSGWG---TTCFLFCSSPDTLQKVEVDLLHYKDCAADTYN 187

  Fly   191 HGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
            :|..:.....:|...::  |..|.|||||||:.:.:.||:|||. ..|....|||||..|:....
  Fly   188 YGSDSILETMVCATGEK--KDACQGDSGGPLVADNKLVGVVSWG-SGCAWTGYPGVYADVASLRS 249

  Fly   256 WI 257
            ||
  Fly   250 WI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 78/234 (33%)
Tryp_SPc 30..259 CDD:238113 79/235 (34%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 78/234 (33%)
Tryp_SPc 31..254 CDD:238113 79/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.