DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss21

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:263 Identity:80/263 - (30%)
Similarity:127/263 - (48%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC-TDGRKASDLSVQYGVTKINA 92
            |:|.|.::.:.::|:..|:| ..|:|.||.:::::::|:||||| .......|.:||:|......
  Rat    57 RIVGGEEAELGRWPWQGSLR-VWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRP 120

  Fly    93 TGPNVVRVKKIIQHED--YNP--YNNYANDISLLLVEEPFEFDGVTVAPVKL--PELAFATPQTD 151
            :..|:.......|.||  .:|  ...:.:||:||.:..|..:... :.|:.|  ....||. :||
  Rat   121 SLWNLQAYSNRYQIEDIFLSPKYTEQFPHDIALLKLSSPVTYSNF-IQPICLLNSTYKFAN-RTD 183

  Fly   152 AGGEGVLIGWGLNATGG----YIQSTLQEVELKVYSDEECTERHGGRTDPRYHI-----CGGVDE 207
            ..    :.|||  |.|.    .:.:.||||::.:.::..|.... .:.|.|.:|     |.|..|
  Rat   184 CW----VTGWG--AIGEDESLPLPNNLQEVQVAIINNTMCNHLF-KKPDFRINIWGDMVCAGSPE 241

  Fly   208 GGKGQC---------SGDSGGPLIYNGQ----QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259
            |||..|         .|||||||:.|..    |||:|||.| .|.....||||..:|.:.:||:.
  Rat   242 GGKDACFAKLTYAAPQGDSGGPLVCNQDTVWYQVGVVSWGI-GCGRPNRPGVYTNISHHYNWIRL 305

  Fly   260 SQI 262
            :.|
  Rat   306 TMI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 77/256 (30%)
Tryp_SPc 30..259 CDD:238113 78/257 (30%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 77/256 (30%)
Tryp_SPc 58..304 CDD:238113 77/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.