DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Send2

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:231 Identity:77/231 - (33%)
Similarity:109/231 - (47%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            |::.|....:|:.|:.:|:: ..|.|.|||||.|...::|||||..|:   ...|:.|....|:.
  Fly    26 RIIGGQPIGIEEAPWQVSIQ-RDGKHLCGGSIYSADIIITAAHCVQGQ---GYQVRAGSALKNSN 86

  Fly    94 GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVL 158
            | :||.|..|..||      ...|||:::.:.:|.||.. .|.|:.|     |......|....:
  Fly    87 G-SVVDVAAIRTHE------GLGNDIAIVRLSKPLEFTN-QVQPIPL-----AKTNPPPGSIAFV 138

  Fly   159 IGWGLNATGGYIQS--TLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPL 221
            .|||   :..|...  .||.|.|.:.....|     |.|:|. .||.|  ..|:..|.|||||||
  Fly   139 SGWG---SSSYYSHPIDLQGVNLYIQWPYYC-----GLTEPS-RICAG--SFGRAACKGDSGGPL 192

  Fly   222 IYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            :::.|.||:||...|.||   |..:|..|..:.:||
  Fly   193 VFDQQLVGVVSGGTKDCT---YSSIYTSVPYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/229 (33%)
Tryp_SPc 30..259 CDD:238113 76/230 (33%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 75/229 (33%)
Tryp_SPc 27..225 CDD:238113 74/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.