DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Phae1

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:267 Identity:82/267 - (30%)
Similarity:127/267 - (47%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC- 72
            |.:..:...:|::.|||: ||||.|:.::|...|:.:||: ..|:|.|..||::..:::||||| 
  Fly    16 LLLLGICRISGVAIGAPE-GRVVGGSPAAVNSAPYAVSMQ-YGGTHYCAASILNANWLVTAAHCL 78

  Fly    73 TDGRKASDLSVQYGVTKINATGPNVVRVKKI---IQHEDYN----PYNNYANDISLLLVEEPFEF 130
            |:..:....::..|...::.|. :..:.:.|   :.::.|.    ||     ||.::.....|.:
  Fly    79 TNSNQVLGSTLVAGSIAVDGTA-STTQTRSITYFVINDLYTGGTVPY-----DIGMIYTPTAFVW 137

  Fly   131 DGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNA---TGGYIQSTLQ-EVELKVYSDEECTERH 191
             ...||||.||.......     |...|.|||..:   |..| .|||| ...:.:.|...|....
  Fly   138 -SAAVAPVTLPSSGVVPT-----GTANLYGWGSTSTTNTASY-PSTLQVATNVPIISLSSCESAL 195

  Fly   192 G--GRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYV 254
            |  |......::|.|...||...|:.||||||:.....:|||||...||..|..|.||.:||.::
  Fly   196 GTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFI 260

  Fly   255 DWIKKSQ 261
            .||..:|
  Fly   261 SWISANQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/241 (30%)
Tryp_SPc 30..259 CDD:238113 74/242 (31%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 73/241 (30%)
Tryp_SPc 36..266 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.