DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Try29F

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:92/250 - (36%)
Similarity:136/250 - (54%) Gaps:27/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISHGA----PQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKAS 79
            :|.||    |:: ||:|.|..::::..|:.:|::.|  .|.||||:|::.:|:||||||:|....
  Fly    27 LSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS--YHFCGGSLIAQGWVLTAAHCTEGSAIL 89

  Fly    80 DLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPE-- 142
            ...|:.|.:: .:.|..:|.:|::.:|..::.| ....|.|||.:|| :....||.|.|.|||  
  Fly    90 LSKVRIGSSR-TSVGGQLVGIKRVHRHPKFDAY-TIDFDFSLLELEE-YSAKNVTQAFVGLPEQD 151

  Fly   143 --LAFATPQTDAGGEGVLI-GWGLNATGGYIQSTLQEVELKVYSDEECTERHG--GRTDPRYHIC 202
              :|..||        ||: |||...:.....:.|:.|.:...|..:|||.:|  |....|. :|
  Fly   152 ADIADGTP--------VLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRM-LC 207

  Fly   203 GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            .|:.||||..|.|||||||..:|...|:|||.. .|....|||||.:||...|||
  Fly   208 AGLPEGGKDACQGDSGGPLAADGVLWGVVSWGY-GCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 85/234 (36%)
Tryp_SPc 30..259 CDD:238113 85/234 (36%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 85/234 (36%)
Tryp_SPc 42..264 CDD:238113 85/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
44.020

Return to query results.
Submit another query.