DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and PRSS38

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:271 Identity:83/271 - (30%)
Similarity:129/271 - (47%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQDLCLAVFALLTTAGISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVM 67
            ||.:.|       |..::.|.|.| |:::.|..:...|:|:.:|:. .:|.|.|||||:::.:|:
Human    40 NQGISL-------TGSVACGRPSMEGKILGGVPAPERKWPWQVSVH-YAGLHVCGGSILNEYWVL 96

  Fly    68 TAAHCTDGRKASDLSVQY-GVTKINATGPNV--VRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
            :||||....|...:...| |:..:...|.:.  ..|.::|.|..|..|:....|::|:.::....
Human    97 SAAHCFHRDKNIKIYDMYVGLVNLRVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIV 161

  Fly   130 FDGVTVAPVKLPELAFATPQTDAGGEGV-LIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGG 193
            | ..:|.||.|     |||:.:...... ..||||.:..|.....|||::|.:..:..|...:| 
Human   162 F-SESVLPVCL-----ATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLLYG- 219

  Fly   194 RTDPRYH--------ICGGVDEGGKGQCSGDSGGPLI--YNGQ--QVGIVSWSIKPCTVAPYPGV 246
                  |        :|.|.....|..|.|||||||:  :|..  |:|||||. :.|:...||||
Human   220 ------HMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWG-RGCSNPLYPGV 277

  Fly   247 YCKVSQYVDWI 257
            |..||.:..||
Human   278 YASVSYFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 73/243 (30%)
Tryp_SPc 30..259 CDD:238113 75/244 (31%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.