DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:237 Identity:88/237 - (37%)
Similarity:126/237 - (53%) Gaps:19/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GRVVNGTDSSVEKYPFVISMRGSSGSHS--CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVT-K 89
            ||:|||..:...|.|:.:.: |.||:..  ||||||:..:|:||||||:|  ||.:::.||.| :
  Fly    35 GRIVNGYPAYEGKAPYTVGL-GFSGNGGWWCGGSIIAHDWVLTAAHCTNG--ASQVTIYYGATWR 96

  Fly    90 INATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGG 154
            .||...:.|.....||  ::|..|...|||:  |:..|.......|..|:||.........| ..
  Fly    97 TNAQFTHTVGSGDFIQ--NHNWPNQNGNDIA--LIRTPHVDFWHMVNKVELPSFNDRYNMYD-NY 156

  Fly   155 EGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGG 219
            ..|..|||| .|.|.....::.|:|::.|:.||:..:|  |.|...:|... .|||..|||||||
  Fly   157 WAVACGWGL-TTAGSQPDWMECVDLQIISNSECSRTYG--TQPDGILCVST-SGGKSTCSGDSGG 217

  Fly   220 PLIYN--GQQVGIVSW-SIKPCTVAPYPGVYCKVSQYVDWIK 258
            ||:.:  |:.||:.|| |...|| |..|..:.:|:..:|||:
  Fly   218 PLVLHDGGRLVGVTSWVSGNGCT-AGLPSGFTRVTNQLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 85/233 (36%)
Tryp_SPc 30..259 CDD:238113 86/235 (37%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 85/233 (36%)
Tryp_SPc 37..260 CDD:238113 86/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.