DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG4271

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:254 Identity:70/254 - (27%)
Similarity:117/254 - (46%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGR 76
            :.|:..|..|:|      :.||.::..:.:.|:.|: ..||.|.|||::|..:.|:|||.|...:
  Fly     7 WVLILFARSSNG------IYNGVEAKFDFWTFLASV-WVSGYHECGGAVIDSRIVLTAAQCVKNK 64

  Fly    77 KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLP 141
            ....::|:.|...| ..|..::||..::.||:   |.|:.|||:||.:|:|       |..|::.
  Fly    65 PVKRITVRVGTPDI-YRGGRIIRVTALVVHEN---YKNWDNDIALLWLEKP-------VLSVRVT 118

  Fly   142 ELAFATPQTDAGGEGVLIGWGLNATGGYI-----QSTLQEVELKVYSDEECTERHGGRTDPRYHI 201
            ::..||.:..........|||......|:     |:.:.::..:....||..|..|...     :
  Fly   119 KIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEELVEPVGEEL-----L 178

  Fly   202 CGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            |....|  ...|.||.||||:...:.|||.... ..|..|..|.:|..|..|::||:::
  Fly   179 CAFYTE--NDICPGDYGGPLVLANKVVGIAVQG-HGCGFAVLPSLYTNVFHYLEWIEEN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 64/232 (28%)
Tryp_SPc 30..259 CDD:238113 66/233 (28%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 66/234 (28%)
Tryp_SPc 19..231 CDD:214473 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.