DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG11911

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:286 Identity:93/286 - (32%)
Similarity:134/286 - (46%) Gaps:54/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQM------GRVVNGTDSSVEKYPFVISMRGS--SGSHSCGGSIISK 63
            |.:|:.|....|.:|....::      |.|:|||::.....|:::|:..:  ..||.|||::|:|
  Fly     8 LVIALVAAAQGAKLSDKLAKLVPSFATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINK 72

  Fly    64 QFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQ---------HEDY----NPYNNY 115
            .:::|||||        :|...|::.|...... ..|.::.|         ||.|    .||   
  Fly    73 DWIVTAAHC--------ISEPVGMSIIAGLHTR-AEVDELTQQRQVDFGRVHEKYTGGVGPY--- 125

  Fly   116 ANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQS---TLQEV 177
              ||:||.|.|.|.|: ..|.|..||     :.:....||..|.|||  ....||.|   |||.|
  Fly   126 --DIALLHVNESFIFN-EWVQPATLP-----SREQVHEGETHLYGWG--QPKSYIFSGAKTLQTV 180

  Fly   178 ELKVYSDEECTERHGGRTDP--RYHICGGVDEGGKGQCSGDSGGPLIYN-----GQQVGIVSWSI 235
            ..::.:.|||.|.. ..:.|  ..:||....:..|..|:|||||||:..     .:.:|||||..
  Fly   181 TTQILNYEECKEEL-PESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGY 244

  Fly   236 KPCTVAPYPGVYCKVSQYVDWIKKSQ 261
            .||.:|..|.:|.|||.|:|||...|
  Fly   245 IPCGLANMPSIYTKVSAYIDWITNIQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 84/252 (33%)
Tryp_SPc 30..259 CDD:238113 86/253 (34%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 86/254 (34%)
Tryp_SPc 37..266 CDD:214473 84/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.