DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss53

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:257 Identity:71/257 - (27%)
Similarity:115/257 - (44%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDL---SVQYG 86
            ||.|..:.|      ::|:..|:| ..|.|.|.||:::..:|:|||||.:....::|   ||..|
Mouse    38 PQEGNTLPG------EWPWQASVR-RQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLG 95

  Fly    87 VTKINATGPNV--VRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTV-APVKLPELAFATP 148
            ..|.....|..  |.|..:...:.||.|:. .:|::||.:..|      || ..:.||:..:..|
Mouse    96 SLKQEGQSPGAEEVGVAALQLPKAYNHYSQ-GSDLALLQLTHP------TVQTTLCLPQPTYHFP 153

  Fly   149 QTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYH------------I 201
               .|......||..|.:.  :..||:.:.|::.|...|...:.     |.|            :
Mouse   154 ---FGASCWATGWDQNTSD--VSRTLRNLRLRLISRPTCNCLYN-----RLHQRLLSNPARPGML 208

  Fly   202 CGGVDEGGKGQCSGDSGGPLIY---NGQ--QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            |||...|.:|.|.||||||::.   :|.  ||||:|::.| |.....|.:...::.:..|::
Mouse   209 CGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSK-CAQEDTPVLLTDMAVHSSWLQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/250 (27%)
Tryp_SPc 30..259 CDD:238113 68/252 (27%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 3/7 (43%)
Tryp_SPc 45..271 CDD:238113 68/250 (27%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.