DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG9673

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:276 Identity:85/276 - (30%)
Similarity:130/276 - (47%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            |.|.:|.|:.:|   ..:|| ||::.|.|.:..:||:..|:|.:. :|.|.|:|||...::||||
  Fly    10 LGLLIFGLILSA---EASPQ-GRILGGEDVAQGEYPWSASVRYNK-AHVCSGAIISTNHILTAAH 69

  Fly    72 CTDG-----RKASDLSVQYGVTKINA-TGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEF 130
            |...     ..||.|:|:.|.  ||. .|.::|.||.:|.|..   |.|:.:||::|.::|...|
  Fly    70 CVSSVGITPVDASTLAVRLGT--INQYAGGSIVNVKSVIIHPS---YGNFLHDIAILELDETLVF 129

  Fly   131 DGVTVAPVKLPELAFATPQTDAGGEGV-----------LIGWG--LNATGGYIQSTLQEVELKVY 182
            .. .:..:.||      |.||...|.|           :.|||  .:.|..|.|   |:......
  Fly   130 SD-RIQDIALP------PTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ---QKANYNTL 184

  Fly   183 SDEECTERHGGRTDPRYH----ICGGVDEGGKGQCSGDSGGPLIYNGQQV-GIVSWSIKPCTVAP 242
            |...|....|      |.    :|....| |:|.|.||:|..:|.:.:.: |:.|::..||. :.
  Fly   185 SRSLCEWEAG------YGYESVVCLSRAE-GEGICRGDAGAAVIDDDKVLRGLTSFNFGPCG-SK 241

  Fly   243 YPGVYCKVSQYVDWIK 258
            ||.|..:||.|:.||:
  Fly   242 YPDVATRVSYYLTWIE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/251 (30%)
Tryp_SPc 30..259 CDD:238113 76/253 (30%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 75/251 (30%)
Tryp_SPc 29..259 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.