DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and sphe

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:123/259 - (47%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFAL--LTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            |.:..|  ||..|:.|.   .||::.|.|:......|..|:| ...:|.|||||:|:..::|.||
  Fly     6 LVILGLIGLTAVGMCHA---QGRIMGGEDADATATTFTASLR-VDNAHVCGGSILSQTKILTTAH 66

  Fly    72 CT--DGR--KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDG 132
            |.  ||:  .||.|:.:.|.|...| |..:|.|:.:..|.||...||  |...:.|..|....|.
  Fly    67 CVHRDGKLIDASRLACRVGSTNQYA-GGKIVNVESVAVHPDYYNLNN--NLAVITLSSELTYTDR 128

  Fly   133 VTVAPVKLPELAFATPQTDAGGEGVLIGWG--LNATGGYIQSTLQEVELKVYSDEECTERHGGRT 195
            :|..|:    :|........|.|.::.|||  .:.|..|   .::::.|||..:..|.:.:....
  Fly   129 ITAIPL----VASGEALPAEGSEVIVAGWGRTSDGTNSY---KIRQISLKVAPEATCLDAYSDHD 186

  Fly   196 DPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259
            :..:.:...:.|   |.|.||.||..||....:|:.::.:..|. :.||.|:.::|.|.|||::
  Fly   187 EQSFCLAHELKE---GTCHGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 68/233 (29%)
Tryp_SPc 30..259 CDD:238113 69/234 (29%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/220 (30%)
Tryp_SPc 42..244 CDD:214473 64/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.