DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG9676

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:233 Identity:83/233 - (35%)
Similarity:125/233 - (53%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT-DGRK---ASDLSVQYGVTK 89
            |:|.||.:...::|..||:| ..|||:||||||||.:|:|||||. .|..   |::|.:|.|...
  Fly    27 RIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLL 90

  Fly    90 INATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGG 154
            :::.|.. |.|..:..|.:   ||:..:|:::|.:.....|:. .:|.:|   ||...|..||..
  Fly    91 LSSGGVR-VPVATVTVHPN---YNSNGHDVAVLRLRNSLTFNS-NIAAIK---LATEDPPNDATV 147

  Fly   155 EGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGG 219
            :  :.|||..:..|.|.::|..|::|..|.|.|.:.: .|..|...:| .:....||.|.|||||
  Fly   148 D--ISGWGAISQRGPISNSLLYVQVKALSRESCQKTY-LRQLPETTMC-LLHPKDKGACYGDSGG 208

  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            |..|.|:.||:.|:.|..|..|. |..|.:||:..:||
  Fly   209 PATYQGKLVGLASFVIGGCGRAA-PDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 81/231 (35%)
Tryp_SPc 30..259 CDD:238113 82/232 (35%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 81/231 (35%)
Tryp_SPc 28..248 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.