DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and gd

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:255 Identity:51/255 - (20%)
Similarity:94/255 - (36%) Gaps:61/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIISKQFVMTAAHC----TDGRKASDLSV---QYGVTKINATGPNVVRVKKIIQHEDYN-PY 112
            ||||::|.:.|:::|||    .....::::.|   ::.:...|..|.....|..|..|.|:| ..
  Fly   280 CGGSLVSARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKNWNEEGSLAAPVDGIYIHPDFNSQL 344

  Fly   113 NNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTD--AGGEGVLIGWGLNATGGYIQSTLQ 175
            ::|..||:::::::...|: ..:.|..|..   .:.:|:  .|..|::|||..:.|.......|.
  Fly   345 SSYDADIAVIILKDEVRFN-TFIRPACLWS---GSSKTEYIVGERGIVIGWSFDRTNRTRDQKLS 405

  Fly   176 E---------------VELKVYSDEEC--TERHGGRTDPRYHICGGVD-------EGGKGQCSGD 216
            .               |:..:..:.||  ...|..........|.|:.       :.|....:|.
  Fly   406 SELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGASIYTGI 470

  Fly   217 SGGPLIYNGQQVGIVSWSIKPCTVAPYPGV-------------------YCKVSQYVDWI 257
            ||..|......    .|.::....|..|.|                   |..|::::|||
  Fly   471 SGAGLFIRRNN----RWMLRGTVSAALPAVETPDAESSHKLCCKNQYIIYADVAKFLDWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 49/253 (19%)
Tryp_SPc 30..259 CDD:238113 51/255 (20%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 49/253 (19%)
Tryp_SPc 258..526 CDD:214473 49/253 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.