DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG33159

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:231 Identity:67/231 - (29%)
Similarity:114/231 - (49%) Gaps:23/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINAT 93
            |:|.|.::::.:.|:::.:| .:|...||||:||.:.|::||||..|.:....:|..|.::::..
  Fly    25 RIVGGKETTISEVPYLVYLR-QNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQE 88

  Fly    94 GPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVL 158
            .|.|..|........|:. .|:..|::||.::|.     |.:.|.|:..::......:......:
  Fly    89 APVVRNVVMFHTSPSYSA-TNFDMDVALLQLQEV-----VVLTPGKVATISPCRNPPEGNAYARI 147

  Fly   159 IGWGLNATGG-----YIQSTLQEVELKVYSDEECT---ERHGGRTDPRYHICGGVDEGGKGQCSG 215
            .|||:.....     .:::|:    ::|....||.   ..:|..:|..  :|..| .|.:..|||
  Fly   148 SGWGVTRENNREPAEQVRTTM----VRVLPGAECKISYSGYGQLSDSM--LCAAV-RGLRDSCSG 205

  Fly   216 DSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS 251
            ||||||:|.||..|||||.. .|....:||||..|:
  Fly   206 DSGGPLVYRGQVCGIVSWGF-GCARPSFPGVYTNVA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/231 (29%)
Tryp_SPc 30..259 CDD:238113 66/230 (29%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 67/231 (29%)
Tryp_SPc 26..251 CDD:238113 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.