DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG32834

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:118/272 - (43%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVFALLTTAGISHGAPQMG------RVVNGTDSSVEKYPF---VISMRGSSGSHSCGGSIISKQF 65
            :||..|..|.:   .|..|      |::.|.|..:|..|:   ||    ..|:..|.|:||:...
  Fly     4 SVFLFLLAALL---RPVRGDLDAQSRIIGGYDVDIEDAPYQAEVI----IDGTAICSGAIITSDT 61

  Fly    66 VMTAAHCTDGRKASDLSVQYGVTKINATGPN-VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
            ::|||.|.  :....:.|:.|.:..:..|.. ::.|.:||.|..||.: .:.|:::||.:.:|.:
  Fly    62 IITAASCV--QSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCW-RFDNNLALLKLCDPLK 123

  Fly   130 FDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNA--------TGGYIQSTLQEVELKVYSDEE 186
             ....:.|:.:.|     .:.|.|....:.|||..:        ..|.:...||...:.||:.|:
  Fly   124 -TSEAIQPISIAE-----DEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQ 182

  Fly   187 CTERHG---GRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYC 248
            |....|   |..|............|.|.||.|:|.||:.:||.|||:|..  .||..  |.||.
  Fly   183 CAADRGVWFGLWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILSEG--GCTTK--PDVYA 243

  Fly   249 KVSQYVDWIKKS 260
            .|..:..||.::
  Fly   244 NVPWFTGWIAEN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 66/242 (27%)
Tryp_SPc 30..259 CDD:238113 67/243 (28%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 66/242 (27%)
Tryp_SPc 27..255 CDD:238113 67/244 (27%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.