DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG32755

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:305 Identity:91/305 - (29%)
Similarity:139/305 - (45%) Gaps:79/305 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISH---GAPQ--------MGRVVNGTDSSVEKYPFVISMRGSS------G-S 53
            :||.:.|  |.:||:.   |.|.        :.::|.|...::::.||.:|:|..|      | .
  Fly     6 MCLLIVA--THSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68

  Fly    54 HSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKINATGPNVVR------------------- 99
            |.|||::||::.|.:||||            |.   ||.:.|.|.|                   
  Fly    69 HVCGGAVISQRVVCSAAHC------------YA---INTSVPLVYRDPELYVVVAGSSAIDRTDR 118

  Fly   100 ------VKKIIQHEDYNPYNNYANDISLLLVEE--PFEFDGVTVAP--VKLPELAFATPQTDAGG 154
                  |::|:.|:|||. :...|||:||.:..  |:|..||...|  :|.||         .|.
  Fly   119 FTQEYLVQRIVGHKDYNG-STLENDIALLFLNGFIPWESPGVRAIPLAIKAPE---------EGT 173

  Fly   155 EGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGG 219
            ..::.||| ..|.....::||:..:.:.:.|.|...:   ..|...:|.|..:||...|.|||||
  Fly   174 TCLIHGWG-KVTMKEKSASLQQAPVPILNKELCQVIY---KLPASQMCAGFLQGGIDACQGDSGG 234

  Fly   220 PLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKSQIIL 264
            |||.:|:..||:||.: .|....|||||..||.::.||:::...|
  Fly   235 PLICDGRLAGIISWGV-GCADPGYPGVYTNVSHFLKWIRRANASL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 80/263 (30%)
Tryp_SPc 30..259 CDD:238113 82/264 (31%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/263 (30%)
Tryp_SPc 38..273 CDD:238113 82/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.