DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG32376

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:113/252 - (44%) Gaps:51/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGS---SGSHSCGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKI 90
            |:|||......:.||    :||   .|...||..||:|.:::||.||..| .....:|:.|..: 
  Fly    65 RIVNGKRIPCTEAPF----QGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQ- 123

  Fly    91 NATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGE 155
            ...|..:..||||:....||.| ...:|::::.::.|..| |..|.|||||    :|..|....:
  Fly   124 QRRGGQLRHVKKIVALAAYNDY-TMRHDLAMMKLKSPVYF-GKCVRPVKLP----STKTTKFPKK 182

  Fly   156 GVLIGWGL-NATGGYIQSTLQEVE-----------------LKVYSDEECTERHGGRTDPRYHIC 202
            .|:.|||: :|....:|..|:.|:                 ||:|.|..|..|            
  Fly   183 FVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASR------------ 235

  Fly   203 GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKK 259
                 ..|..|||||||||...|...|||||.| .|....|||||....:||.||||
  Fly   236 -----TNKDSCSGDSGGPLTSRGVLYGIVSWGI-GCANKNYPGVYVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 80/248 (32%)
Tryp_SPc 30..259 CDD:238113 81/249 (33%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 80/248 (32%)
Tryp_SPc 66..287 CDD:238113 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
33.010

Return to query results.
Submit another query.