DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk14

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:235 Identity:73/235 - (31%)
Similarity:121/235 - (51%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVVNGTDSSVEKYPFVISMRGSSGSH-SCGGSIISKQFVMTAAHCTDGRKASDLSV-QYGVTKIN 91
            :::.|........|:.::::...|.. .|||.::|.|:|:|||||  .|....::: ::.:.:..
Mouse    23 KIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHC--ARPILHVALGKHNIRRWE 85

  Fly    92 ATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEG 156
            || ..||||.:.:.|..|.| ..:.||:.||.:::.... |..|..:.:.. :.|:|.|...   
Mouse    86 AT-QQVVRVARQVPHPQYQP-QAHDNDLMLLKLQKKVRL-GRAVKTISVAS-SCASPGTPCR--- 143

  Fly   157 VLIGWGLNATG-GYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGP 220
             :.|||..|:. ....:.||.|.:.:.|::.|...:.|...... :|.||.||||..|.||||||
Mouse   144 -VSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGM-VCAGVPEGGKDSCQGDSGGP 206

  Fly   221 LIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            |:..||..|:|||.::.|.:..|||||..:..|..||:::
Mouse   207 LVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 71/230 (31%)
Tryp_SPc 30..259 CDD:238113 73/231 (32%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.