DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk15

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:262 Identity:87/262 - (33%)
Similarity:123/262 - (46%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            |..|.||.:|     |....:|:.|.:......|:.::: ...|..:||..:||.::|:||||| 
Mouse     4 LLAFVLLVSA-----AQDGDKVLEGEECVPHSQPWQVAL-FERGRFNCGAFLISPRWVLTAAHC- 61

  Fly    74 DGRKASDLSVQYGVTKINA-TGPNVVR-VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVA 136
               :...:.|:.|...:.. .||..:| |.:||.|..|.. ..:.:||.||.:.:|...... |.
Mouse    62 ---QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEA-RTHRHDIMLLRLFKPARLTAY-VR 121

  Fly   137 PVKLPELAFATPQTDAGGEGVLIGWGL------NATGGY-----IQSTLQEVELKVYSDEECTER 190
            ||.||.   ..|.  .|.:.|:.||||      .|||..     :..||....:.:.|:..|.:.
Mouse   122 PVALPR---RCPL--IGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKD 181

  Fly   191 HGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVD 255
            :.||..|.. :|.||:.||...|.|||||||:..|...|||||...||.....||||.||..|::
Mouse   182 YPGRVLPTM-VCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLE 245

  Fly   256 WI 257
            ||
Mouse   246 WI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 79/240 (33%)
Tryp_SPc 30..259 CDD:238113 81/241 (34%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 78/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 158 1.000 Inparanoid score I4246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.