DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prtn3

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:248 Identity:79/248 - (31%)
Similarity:123/248 - (49%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTTAGIS-HGAPQMGRVVNGTDSSVEKYPFVISMR--GSSGSHSCGGSIISKQFVMTAAHCTDGR 76
            |..||:. |||.|..::|.|.::.....|:|.|::  .|.|||.|||::|..:||:|||||....
  Rat   182 LRLAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDI 246

  Fly    77 KASDLSVQYGVTKINATGPNVVR--VKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVK 139
            ....::|..|...:.::.|...:  :.::.:: :||| ....||:.||.:..|... |..||...
  Rat   247 SWQLVTVVLGAHDLLSSEPEQQKFTITQVFEN-NYNP-EETLNDVLLLQLNRPASL-GKQVAVAS 308

  Fly   140 LPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERHGGRTDPRYHICGG 204
            ||:...:..|   |.:.:.:|||...|.......|.|:.:.|.: ..|.|         :::|..
  Rat   309 LPQQDQSLSQ---GTQCLAMGWGRLGTRAPTPRVLHELNVTVVT-FLCRE---------HNVCTL 360

  Fly   205 VDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            |.....|.|.||||||||.||...|:.|:.|:.|....:|..:.:||.||:||
  Rat   361 VPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/231 (30%)
Tryp_SPc 30..259 CDD:238113 72/232 (31%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 72/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.