DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and CG14780

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:272 Identity:81/272 - (29%)
Similarity:125/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMR-----GSSGS-HSCGGSIISKQFVMTAAHC 72
            ||..|.......|..|::||:.:..::...::|:|     .:.|| |.|||::|:.:.|:|||||
  Fly    17 LLACAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHC 81

  Fly    73 TDG------RKASDLSVQYGVTK--INATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEE--P 127
            ...      |:||:..|..|...  .:..|..|.:|..:.....::| ::..:|:.:|.:..  |
  Fly    82 LYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSP-DSMRDDVGILFLRTGLP 145

  Fly   128 FEFDG---VTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTE 189
            ....|   :||||::|     |...|..|....:.|||...     ||:|..:.|   :....|.
  Fly   146 MSPGGGVHLTVAPIQL-----AGQITPPGKLCQVAGWGRTE-----QSSLSNILL---TANVSTI 197

  Fly   190 RHGGRTDPRYH--------ICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGV 246
            ||  :|....:        :|.|..:||...|.|||||||::.|:.||:|||.. .|.....|||
  Fly   198 RH--QTCRMIYRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGY-GCAEPGLPGV 259

  Fly   247 YCKVSQYVDWIK 258
            |..|..|..||:
  Fly   260 YVDVEYYRQWIE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/254 (30%)
Tryp_SPc 30..259 CDD:238113 76/256 (30%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 75/254 (30%)
Tryp_SPc 33..271 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.