DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss30

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:270 Identity:93/270 - (34%)
Similarity:136/270 - (50%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKA 78
            |.:..|.|..|   |::|.|.|:...::|:.:|:..:...|.||||:|.:.:|:|||||.  |::
Mouse    61 LPSVCGHSRDA---GKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCF--RRS 120

  Fly    79 SDLS---VQYGVTKINATGPN--VVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPV 138
            .:.|   |:.|...::...|:  :|.|:.|..|..|...:..:.||:|:.::.|......|  ||
Mouse   121 LNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFT--PV 183

  Fly   139 KLPELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTERH--------GGRT 195
            .||  |..||.| .|....:.|||...... :.|.|||:.:.:...|:|.:.:        |.|.
Mouse   184 CLP--AAQTPLT-PGTVCWVTGWGATQERD-MASVLQELAVPLLDSEDCEKMYHTQGSSLSGERI 244

  Fly   196 DPRYHICGGVDEGGKGQCSGDSGGPLI----YNGQQVGIVSWSIKPCTVAPY-PGVYCKVSQYVD 255
            .....:|.|..||.|..|.|||||||:    .:..||||.||.| .| ..|| ||||.:|..|||
Mouse   245 IQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGI-GC-ARPYRPGVYTRVPTYVD 307

  Fly   256 WIKKSQIILA 265
            ||::   |||
Mouse   308 WIQR---ILA 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 83/245 (34%)
Tryp_SPc 30..259 CDD:238113 85/246 (35%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 85/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.