DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk12

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:263 Identity:81/263 - (30%)
Similarity:119/263 - (45%) Gaps:37/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSH-SCGGSIISKQFVMTAAHC 72
            |.:..||...|:|....:  ::.||.:......|:.:.:  ..|.: .|||.::.:::|:|||||
  Rat     3 LNILLLLCVVGLSQADRE--KIYNGVECVKNSQPWQVGL--FHGKYLRCGGVLVDRKWVLTAAHC 63

  Fly    73 TDGR----------KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEP 127
            : |:          ...||:.|..:|..:.|.|:.           :..|.|:.:|:.||.:..|
  Rat    64 S-GKYMVRLGEHSLSKLDLTEQLRLTTFSITHPSY-----------HGAYQNHEHDLRLLRLNRP 116

  Fly   128 FEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEECTERH 191
            .... ..|.||.||.....|     |.:..:.||| .|.........||.::|.:.|:|.|....
  Rat   117 ISLT-YAVRPVALPSSCAPT-----GAKCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVF 175

  Fly   192 GGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSW-SIKPCTVAPYPGVYCKVSQYVD 255
            .||........||  |.||..|.|||||||:..|...|:||| |:.||.....||||.||.:|.|
  Rat   176 PGRVTENMLCAGG--EAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTD 238

  Fly   256 WIK 258
            ||:
  Rat   239 WIR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 74/240 (31%)
Tryp_SPc 30..259 CDD:238113 76/242 (31%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.