DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk14

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:259 Identity:80/259 - (30%)
Similarity:127/259 - (49%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGI-SHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSH-SCGGSIISKQFVMTA 69
            |.|.:...|..|.: |.|.   .:::.|........|:.::::...|.. .|||.::|.|:|:||
  Rat    63 LLLTILQALAVAIVQSQGD---DKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSDQWVITA 124

  Fly    70 AHCTDGRKASDLSV-QYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFD-G 132
            |||  .|....::: ::.:.:..|| ..|:||.:.:.|..|.| ..:.||:.||.::...... .
  Rat   125 AHC--ARPLLHVALGKHNLRRWEAT-QQVLRVVRQVPHPQYRP-QAHDNDLMLLKLQRKVRLGRA 185

  Fly   133 VTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQST-LQEVELKVYSDEECTERHGGRTD 196
            |...||   ..:.|:|.|...    :.|||..|:......| ||.|.:.:..::.|...:.| |.
  Rat   186 VRTIPV---ARSCASPGTPCR----VSGWGTTASPIVRYPTALQCVNVNIMPEQVCHRAYPG-TI 242

  Fly   197 PRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKKS 260
            ....:|.||.||||..|.|||||||:..||..|:|||.::.|.:..|||||..:..|..||:::
  Rat   243 TSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWIQRT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/231 (31%)
Tryp_SPc 30..259 CDD:238113 74/232 (32%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 74/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.