DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss22

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:277 Identity:83/277 - (29%)
Similarity:134/277 - (48%) Gaps:33/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLT-TAGIS----HGAP------QMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIIS 62
            |.:..||| ||.:|    .|:|      |:.|||.|.||:..::|:::|:. .:|||.|.||:::
  Rat    18 LILLVLLTSTATVSAANIRGSPDCGKPQQLNRVVGGEDSADAQWPWIVSIL-KNGSHHCAGSLLT 81

  Fly    63 KQFVMTAAHCTDGR--KASDLSVQYGVTKINATGP--NVVRVKKIIQHEDYNPYNNYANDISLLL 123
            .::|::||||....  |.|..||..|..|:...||  ..|.:..::.|..|:.......||:|:.
  Rat    82 NRWVVSAAHCFSSNMDKPSPYSVLLGAWKLGNPGPRSQKVGIASVLPHPRYSRKEGTHADIALVR 146

  Fly   124 VEEPFEFDGVTVAPVKLPELA-FATPQTDAGGEGVLIGWGLNATGGYI--QSTLQEVELKVYSDE 185
            :|.|.:| ...:.|:.||:.: ...|.|:..    :.|||....|..:  ..|||::::.:...|
  Rat   147 LERPIQF-SERILPICLPDSSVHLPPNTNCW----IAGWGSIQDGVPLPRPQTLQKLKVPIIDPE 206

  Fly   186 ECTERH----GGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQ----VGIVSWSIKPCTVAP 242
            .|...:    |........:|.|..||.:..|.|||||||:.....    .||:||. :.|....
  Rat   207 LCKSLYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQVDDHWLLTGIISWG-EGCAERN 270

  Fly   243 YPGVYCKVSQYVDWIKK 259
            .||||..:..:..|:::
  Rat   271 RPGVYTSLLAHRPWVQR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/242 (30%)
Tryp_SPc 30..259 CDD:238113 72/243 (30%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 72/242 (30%)
Tryp_SPc 50..288 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.