DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Elane

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:266 Identity:78/266 - (29%)
Similarity:125/266 - (46%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQDLCLAVFALLTTAGISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVM 67
            ||.|...:.|||..      .|.: ..:|.|..:....:||::|:: ..|.|.||.::|::.|||
  Rat    12 NQTLASMLLALLLV------CPALASEIVGGRPAQPHAWPFMVSLQ-RRGGHFCGATLIARNFVM 69

  Fly    68 TAAHCTDGRKASDLSVQYGVTKINATGP--NVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEF 130
            :||||.:||....:.|..|...:....|  .:..|::|.:: .::| :...|||.::      :.
  Rat    70 SAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFEN-GFDP-SRLLNDIVII------QL 126

  Fly   131 DG-VTV-APVKLPELAFATPQTDAGGEG-------VLIGWGLNATGGYIQSTLQEVELKVYSDEE 186
            :| .|: |.|::.||       .|.|:|       |.:|||...|...:.|.|||:.:.|.:: .
  Rat   127 NGSATINANVQVAEL-------PAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVTN-L 183

  Fly   187 CTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVS 251
            |..        |.::|..|.....|.|.|||||||:.|....||.|:....|....||..:..|:
  Rat   184 CRR--------RVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVA 240

  Fly   252 QYVDWI 257
            ::.|||
  Rat   241 EFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 69/238 (29%)
Tryp_SPc 30..259 CDD:238113 71/239 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 69/238 (29%)
Tryp_SPc 33..249 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.