DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk1c8

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:270 Identity:80/270 - (29%)
Similarity:121/270 - (44%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCT 73
            |.:|.:|:........|...|::.|.:......|:.:::. ......|||.:|...:|:||||| 
  Rat     4 LILFLILSLGWNDAAPPGQSRIIGGFNCEKNSQPWQVAVY-HFNEPQCGGVLIHPSWVITAAHC- 66

  Fly    74 DGRKASDLSVQYGV----------------TKINATGPNVVRVKKIIQHEDYNPYNNYANDISLL 122
                   .||.|.|                ..::.:.|:......||::....|.|:|:||:.||
  Rat    67 -------YSVNYQVWLGRNNLLEDEPFAQHRLVSQSFPHPGFNLDIIKNHTRKPGNDYSNDLMLL 124

  Fly   123 LVEEPFEF-DGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDE 185
            .::.|.:. |||.|  :.||     |.:...|...:..||| :..........||.|.:.:.|:|
  Rat   125 HLKTPADITDGVKV--IDLP-----TEEPKVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNE 182

  Fly   186 ECTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCK 249
            :|.:.:... ||  ..:|.|..:|||..|.||||||||.:|...||.||...||.....|.||.|
  Rat   183 KCIKAYNDEVTD--VMLCAGEMDGGKDICKGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTK 245

  Fly   250 VSQYVDWIKK 259
            :.::..||||
  Rat   246 LIKFTSWIKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/246 (29%)
Tryp_SPc 30..259 CDD:238113 73/247 (30%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 72/246 (29%)
Tryp_SPc 25..256 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.