DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk7

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:248 Identity:72/248 - (29%)
Similarity:117/248 - (47%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHCTDGRKAS 79
            |.|||      |..|:::|.......:|:.:::......| |||.::.:.:|:|||||    |..
  Rat    17 LETAG------QGERIIDGYKCKEGSHPWQVALLKGDQLH-CGGVLVGESWVLTAAHC----KMG 70

  Fly    80 DLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELA 144
            ..:|..|..||.......::..:..:|..|:. ..:.|||.|:.:::|.:... .|..||||:  
  Rat    71 QYTVHLGSDKIEDQSAQRIKASRSFRHPGYST-RTHVNDIMLVKMDKPVKMSD-KVQKVKLPD-- 131

  Fly   145 FATPQTDAGGEGVLIGWGLNATGGY-IQSTLQEVELKVYSDEECTERHG---GRTDPRYHICGGV 205
            ...|   .|....:.|||...:... ..|.|...::|:.|.:||.:.:.   |:|    .:|.|:
  Rat   132 HCEP---PGTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECKKVYKDLLGKT----MLCAGI 189

  Fly   206 DEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258
            .:.....|:|||||||:.|....|:|||...||.....||||.:|.:|..|::
  Rat   190 PDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYQRWLE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 66/231 (29%)
Tryp_SPc 30..259 CDD:238113 66/233 (28%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 66/230 (29%)
Tryp_SPc 26..244 CDD:238113 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.