DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk11

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:272 Identity:74/272 - (27%)
Similarity:116/272 - (42%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAVFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAH 71
            :.|...||....|...|..   |::.|.:......|:.:::...: ...||.::|:.::::||||
  Rat    31 MILRFIALALVTGHVGGET---RIIKGYECRPHSQPWQVALFQKT-RLLCGATLIAPKWLLTAAH 91

  Fly    72 C----------------TDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYN---PYNNYAN 117
            |                |||.:...::.:                  ...|..:|   |..::.|
  Rat    92 CRKPHYVILLGEHNLEKTDGCEQRRMATE------------------SFPHPGFNNSLPNKDHRN 138

  Fly   118 DISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGY-IQSTLQEVELKV 181
            ||.|:.:..| .|....|.|:.|..|.     ..||...::.|||..::... :..:|:...:.:
  Rat   139 DIMLVKMSSP-AFITRAVRPLTLSSLC-----VTAGTSCLISGWGTTSSPQLRLPHSLRCANVSI 197

  Fly   182 YSDEECTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPG 245
            ...:||...:.|. ||..  :|..|.:.||..|.|||||||:.||...||:||...||.|...||
  Rat   198 IGHKECERAYPGNITDTM--LCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPG 260

  Fly   246 VYCKVSQYVDWI 257
            ||.||.:|.|||
  Rat   261 VYTKVCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/248 (27%)
Tryp_SPc 30..259 CDD:238113 68/249 (27%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 67/248 (27%)
Tryp_SPc 51..275 CDD:238113 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.