DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Prss34

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:294 Identity:83/294 - (28%)
Similarity:136/294 - (46%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLAV--FALLTTAGISHGAP-------QMGRVVNGTDSSVEKYPFVISMRG-----SSGSHSCG 57
            :||.:  |..||...:....|       ::..:|.|...|..::|:.:|:|.     |...|.||
  Rat     1 MCLGMLWFLFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICG 65

  Fly    58 GSIISKQFVMTAAHCTDGR--KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYAN--D 118
            ||:|..|:|:|||||.:.:  :||...||.|..:: .....:::|.|||:|..::...:...  |
  Rat    66 GSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRL-YENDQLMKVAKIIRHPKFSEKLSAPGGAD 129

  Fly   119 ISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQS--------TLQ 175
            |:||.::..... ...|.||.||.   |:.:..:.....:.|||:      |:.        .|:
  Rat   130 IALLKLDSTVVL-SERVHPVSLPA---ASQRISSKKTWWVAGWGV------IEGHRPLPPPCHLR 184

  Fly   176 EVELKVYSDEECTERHGGRTDPRYH-------------ICGGVDEGGKGQCSGDSGGPLIYNGQ- 226
            ||.:.:..:.:|.:::  ||   |.             :|.|::  |:..|..||||||:.... 
  Rat   185 EVAVPIVGNSDCEQKY--RT---YSSLDRTTKIIKDDMLCAGME--GRDSCQADSGGPLVCRWNC 242

  Fly   227 ---QVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
               |||:|||.| .|.:..:||||.:|..|:.||
  Rat   243 SWVQVGVVSWGI-GCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 75/261 (29%)
Tryp_SPc 30..259 CDD:238113 77/262 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 77/262 (29%)
Tryp_SPc 33..275 CDD:214473 75/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.