DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK9

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:220 Identity:68/220 - (30%)
Similarity:105/220 - (47%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 CGGSIISKQFVMTAAHCTDGRKASDLSVQYGVTKI-NATGP-NVVRVKKIIQHEDYN---PYNNY 115
            ||.::||.::::|||||   ||.. |.|:.|...: ...|| .:.||.....|..:|   ..|::
Human    48 CGATLISDRWLLTAAHC---RKPY-LWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDH 108

  Fly   116 ANDISLLLVEEPFEFDGVTVAPVKLPELAFATP--------QT--DAGGEGVLIGWG-LNATGGY 169
            .:||.|                ::||..|..:|        ||  ..|.:.::.||| :::....
Human   109 NDDIML----------------IRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKAL 157

  Fly   170 IQSTLQEVELKVYSDEECTERHGGRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWS 234
            ...|||...:.:..::.|...:.|...... :|.|:.|||:|.|.|||||||:.||...|:||..
Human   158 FPVTLQCANISILENKLCHWAYPGHISDSM-LCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGG 221

  Fly   235 IKPCTVAPYPGVYCKVSQYVDWIKK 259
            .:||:....|.||..|..|:|||::
Human   222 AEPCSRPRRPAVYTSVCHYLDWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 66/216 (31%)
Tryp_SPc 30..259 CDD:238113 68/218 (31%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 68/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.