DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK13

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:280 Identity:92/280 - (32%)
Similarity:132/280 - (47%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VFALLTTAGISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSG---------SHS----------- 55
            |.|.||.| :|.|..|        :||.     |::..|:||         .||           
Human     7 VIASLTLA-LSGGVSQ--------ESSK-----VLNTNGTSGFLPGGYTCFPHSQPWQAALLVQG 57

  Fly    56 ---CGGSIISKQFVMTAAHC-TDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYN---PYN 113
               |||.::..::|:||||| .:|.|.  ...::.:.::.| |..|..|...|.|.:|.   .:.
Human    58 RLLCGGVLVHPKWVLTAAHCLKEGLKV--YLGKHALGRVEA-GEQVREVVHSIPHPEYRRSPTHL 119

  Fly   114 NYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQ--STLQE 176
            |:.:||.||.::.|.:..|. :..:.|......||.|...    :.||| ..|...:.  .|||.
Human   120 NHDHDIMLLELQSPVQLTGY-IQTLPLSHNNRLTPGTTCR----VSGWG-TTTSPQVNYPKTLQC 178

  Fly   177 VELKVYSDEECTERHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTV 240
            ..:::.|||||.:.:.|: ||..  :|.|..||||..|.|||||||:.|....|||||...||..
Human   179 ANIQLRSDEECRQVYPGKITDNM--LCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQ 241

  Fly   241 APYPGVYCKVSQYVDWIKKS 260
            ...||||.:||:||.||:::
Human   242 PDRPGVYTRVSRYVLWIRET 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 82/257 (32%)
Tryp_SPc 30..259 CDD:238113 84/258 (33%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.