DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and PRSS33

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:285 Identity:89/285 - (31%)
Similarity:129/285 - (45%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLAVFALLT-----TAG---ISHGAPQM-GRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISK 63
            ||.|..||.     |.|   .:.|.|:| .|:|.|.|....::|:..|:: ..|:|.||||:|:.
Human     6 CLQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQ-HRGAHVCGGSLIAP 69

  Fly    64 QFVMTAAHCTDGRK-ASDLSVQYGVTKINATGPNV--VRVKKIIQHEDYNPYNNYANDISLLLVE 125
            |:|:|||||...|. .::..|:.|..::.:|.|..  |.|::::...||:. :....|::||.:.
Human    70 QWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSE-DGARGDLALLQLR 133

  Fly   126 EPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWGLNATGGYIQS--TLQEVELKVYSDEECT 188
            .|... ...|.||.||......|   .|....:.|||....|..:..  .||.|.:.:.....| 
Human   134 RPVPL-SARVQPVCLPVPGARPP---PGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTC- 193

  Fly   189 ERHGGRTDPRYHI----------------CGGVDEGGKGQCSGDSGGPL--IYNGQ--QVGIVSW 233
                   |..||:                |.|..:|.|..|.|||||||  :.:|.  .||:|||
Human   194 -------DGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSW 251

  Fly   234 SIKPCTVAPYPGVYCKVSQYVDWIK 258
            . |.|.:...||||..|:.|..||:
Human   252 G-KGCALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 77/252 (31%)
Tryp_SPc 30..259 CDD:238113 78/254 (31%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.