DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and KLK5

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:263 Identity:68/263 - (25%)
Similarity:123/263 - (46%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQDLCLAVFALLTTAGISHGA---PQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQF 65
            ||||         .||....|   ....|::||:|..:...|:..::........||..::..|:
Human    47 NQDL---------GAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQW 102

  Fly    66 VMTAAHCTDGRKASDLSV-QYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFE 129
            ::|||||.  :|...:.: .|.::.:..:|..:.:..|.|.|..|: :..::||:.|:.:..   
Human   103 LLTAAHCR--KKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYS-HPGHSNDLMLIKLNR--- 161

  Fly   130 FDGVTVAPVK-LPELAFATPQTDAGGEGVLIGWGLNATGG-YIQSTLQEVELKVYSDEECTERHG 192
                .:.|.| :..:..::....||.:.::.|||...:.. :....||.:.:.|.|.:.|.:.:.
Human   162 ----RIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYP 222

  Fly   193 GRTDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257
            .:.|... .|.| |:.|:..|.||||||::.||...|:|||...||.....||||..:.::..||
Human   223 RQIDDTM-FCAG-DKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWI 285

  Fly   258 KKS 260
            :::
Human   286 QET 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 59/230 (26%)
Tryp_SPc 30..259 CDD:238113 60/231 (26%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 8/29 (28%)
Tryp_SPc 66..285 CDD:214473 59/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4287
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8476
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.