DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16749 and Klk1c2

DIOPT Version :9

Sequence 1:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036809.1 Gene:Klk1c2 / 24841 RGDID:3888 Length:259 Species:Rattus norvegicus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:125/266 - (46%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVFALLTTAG-ISHGAPQMGRVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFVMTAAHC 72
            |.:.:|:.:.| |....|...|:|.|........|:.:::   ...:.|||.:|...:|:|||||
  Rat     3 LQILSLVLSVGRIDAAPPGQSRIVGGYKCEKNSQPWQVAV---INEYLCGGVLIDPSWVITAAHC 64

  Fly    73 TDGRKASDLSVQYGVTKINATGPNVVR--VKKIIQHEDY----------NPYNNYANDISLLLVE 125
                .:::..|..|...:....|...|  |::..:|.||          .|.::::||:.||.:.
  Rat    65 ----YSNNYQVLLGRNNLFKDEPFAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLS 125

  Fly   126 EPFEFDGVTVAPVKLPELAFATPQTDAGGEGVLIGWG-LNATGGYIQSTLQEVELKVYSDEECTE 189
            ||.:..| .|..:.||     |.:...|...:..||| .|.:...:...||.|.:.:.|:|:|.|
  Rat   126 EPADITG-GVKVIDLP-----TKEPKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCIE 184

  Fly   190 RHGGR-TDPRYHICGGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQY 253
            .:... ||  ..:|.|..||||..|:||||||||.:|...||.|....||.....|.:|.|:.::
  Rat   185 TYKDNVTD--VMLCAGEMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKF 247

  Fly   254 VDWIKK 259
            ..||||
  Rat   248 TSWIKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 72/241 (30%)
Tryp_SPc 30..259 CDD:238113 73/242 (30%)
Klk1c2NP_036809.1 Tryp_SPc 24..251 CDD:214473 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.